IL-13, Human (114a.a, CHO)
Cat# HY-P7033-50ug
Size : 50ug
Brand : MedChemExpress
Please arrange your schedule properly.
- United States
- Canada
- United Kingdom
- Australia
- Germany
- France
- Japan
- Korea South
- Switzerland
- Algeria
- Argentina
- Austria
- Belgium
- Brazil
- Chile
- Croatia
- Czech Republic
- Denmark
- Finland
- Hong Kong, China
- Hungary
- India
- Iraq
- Ireland
- Israel
- Italy
- Lebanon
- Luxembourg
- Malaysia
- Mexico
- Morocco
- Netherlands
- New Zealand
- Norway
- Pakistan
- Peru
- Philippines
- Poland
- Portugal
- Qatar
- Russia
- Saudi Arabia
- Serbia
- Singapore
- Slovakia
- Slovenia
- South Africa
- Spain
- Sweden
- Taiwan, China
- Thailand
- Tunisia
- Turkey
- Ukraine
- Macao, China
- Other Countries
IL-13 Protein, Human (114a.a, CHO)
- Cat. No.: HY-P7033
- COA Instruction de manipulation
IL-13 Protein, Human (CHO) is a CHO cell derived cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
Size | Prix | Stock | Quantité |
---|---|---|---|
Échantillon gratuit | Apply now | ||
2 μg | $35 | En stock | |
10 μg | $85 | En stock | |
50 μg | $235 | En stock | |
100 μg | $400 | En stock | |
> 100 μg | Obtenir un devis |
* Veuillez sélectionner la quantité avant d'ajouter des articles.
Activité biologique
Paramètres Techniques
Propriétés
Description
Références
Description |
IL-13 Protein, Human (CHO) is a CHO cell derived cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. |
---|---|
Background |
Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. Interleukin- 13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation, Ig class switching to IgE synthesis, and enhanced production of IgG4 and IgM. In human macrophages and monocytes,hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1]. |
Activité biologique |
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is ≤24.04 ng/mL, corresponding to a specific activity is ≥4.20×104 U/mg.
|
Species |
Human |
Source |
CHO |
Tag |
Tag Free |
Accession |
P35225 (S33-N146) |
Gene ID | |
Molecular Construction |
N-term
IL-13 (S33-N146)
Accession # P35225 C-term
|
Synonyms |
rHuIL-13; NC30
|
AA Sequence |
SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Masse moléculaire |
10-25 kDa, under reducing conditions & 25-45 kDa, under non-reducing conditions |
Pureté |
|
Appearance |
Lyophilized powder. |
Formulation |
Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4. |
Endotoxin Level |
<1 EU/μg, determined by LAL method. |
Reconstitution |
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose). |
Storage & Stability |
Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage. |
Livraison |
Room temperature in continental US; may vary elsewhere. |
Documentation |
|
Références |
IL-13 Protein, Human (114a.a, CHO) Related Classifications
-
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.
Reconstitution Calculator
Dilution Calculator
Specific Activity Calculator
The reconstitution calculator equation
Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
The dilution calculator equation
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
This equation is commonly abbreviated as: C1V1 = C2V2
The specific activity calculator equation
Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Vos produits récemment consultés:
Demande en ligne
Your information is safe with us. * Required Fields.
Bulk Inquiry
Inquiry Information
- Nom du produit:
- IL-13 Protein, Human (114a.a, CHO)
- Cat. No.:
- HY-P7033
- Quantité:
- MCE Japan Authorized Agent: