Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His)
Cat# NB-64-50126-200ug
Size : 200ug
Brand : Neo Biotech
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His) is expressed in Yeast. |
| Species | HHV-6A |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | P52439 |
| Synonyms | U27,Polymerase accessory protein (PAP),Phosphoprotein P41 (PP41),EPLF1,DNA polymerase processivity factor |
| Amino Acid | MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV |
| Construction | 1-393 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 46.8 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization. |
Dose Conversion
You can also refer to dose conversion for different animals. More

