gB Recombinant Protein
Cat# OPCA03429-1MG
Size : 1mg
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
GB Recombinant Protein (HHV-4) (OPCA03429)
| Datasheets/Manuals | Printable datasheet for GB Recombinant Protein (HHV-4) (OPCA03429) |
|---|
| Predicted Species Reactivity | Epstein-Barr virus|Epstein-Barr Virus|Human Gammaherpesvirus 4 |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Epstein-Barr virus |
| Additional Information | Relevance: Envelope glycoprotein that forms spikes at the surface of virion envelope. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding of gp350/220 to its receptor, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV |
| Protein Sequence | QTPEQPAPPATTVQPTATRQQTSFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKIVTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRDGVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSPFDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIV |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 23-260 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Epstein-Barr virus glycoprotein homologous to herpes simplex virus gB.Gong M., Ooka T., Matsuo T., Kieff E.J. Virol. 61:499-508(1987) |
|---|---|
| Gene Symbol | BALF4 |
| Gene Full Name | envelope glycoprotein B |
| Alias Symbols | envelope glycoprotein B, HHV4_BALF4. |
| NCBI Gene Id | 3783680 |
| Protein Name | Envelope glycoprotein B |
| Description of Target | Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress. |
| Uniprot ID | P03188 |
| Protein Accession # | YP_401713.1 |
| Nucleotide Accession # | NC_007605.1 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 43.3 kda |
