- Specifications
Product Description
Mouse monoclonal antibody raised against a full-length recombinant FGFR1OP.
Immunogen
FGFR1OP (AAH11902, 1 a.a. ~ 379 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Host
Mouse
Reactivity
Human
Isotype
IgG Mix Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (67.42999999999999 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Immunofluorescence
Immunofluorescence of monoclonal antibody to FGFR1OP on HeLa cell . [antibody concentration 10 ug/ml]ELISA
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGFR1OP is approximately 0.03ng/ml as a capture antibody.Western Blot (Transfected lysate)
Western Blot analysis of FGFR1OP expression in transfected 293T cell line by FGFR1OP monoclonal antibody (M01), clone 2B1.
Lane 1: FGFR1OP transfected lysate(43.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
- Gene Info — FGFR1OP
Entrez GeneID
11116GeneBank Accession#
BC011902Protein Accession#
AAH11902Gene Name
FGFR1OP
Gene Alias
FOP
Gene Description
FGFR1 oncogene partner
Omim ID
605392Gene Ontology
HyperlinkGene Summary
This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000017612|OTTHUMP00000017613|fibroblast growth factor receptor 1 oncogene partner
- Interactomes
- Diseases
- Publication Reference
- Enhanced release of ciliary extracellular vesicles suppresses cell migration and promotes cell aggregation.
Tetsuhiro Hara, Ryota Nakazato, Kenji Shirakawa, Faryal Ijaz, Kenichiro Uemura, Shinya Takahashi, Koji Ikegami
Cell Struct Funct 2026 Feb; 51(1):67-79.
- A CRISPR activation screen reveals a cilia disassembly pathway mutated in focal cortical dysplasia.
Shane D Elliott, Paul J Ready, Caitlin M Wrinn, Qianqian Ma, Marina Edward, Robert F Niescier, Iris Escobar, Jingbo Sun, Anil Kumar Ganga, Ceara K McAtee, ?rem Sude Ati?, Anthony J Koleske, Angelique Bordey, David K Breslow
Sci Adv 2025 Oct; 11(44):eaeb7238.
Application:ICC-IF.
- eIF2A regulates cell migration in a translation-independent manner.
Jennifer Jungfleisch, Neus Mestre-Farràs, Raúl Gómez-Riera, Oriane Pourcelot, Edouard Bertrand, Nadia Halidi, Fátima Gebauer.
Science Advances 2025 Aug; 11(31):eadu5668.
Application:IF, Human, UACC-62 cell.
- mTOR controls ependymal cell differentiation by targeting the alternative cell cycle and centrosomal proteins.
Alexia Bankole, Ayush Srivastava, Asm Shihavuddin, Khaled Tighanimine, Marion Faucourt, Vonda Koka, Solene Weill, Ivan Nemazanyy, Alissa J Nelson, Matthew P Stokes, Nathalie Delgehyr, Auguste Genovesio, Alice Meunier, Stefano Fumagalli, Mario Pende, Nathalie Spassky.
EMBO Reports 2025 Apr; [Epub]:0.
Application:IS, Mouse, Brain.
- Synchronized temporal-spatial analysis via microscopy and phosphoproteomics (STAMP) of quiescence.
Mohammad Ovais Azizzanjani., Rachel E Turn., Anushweta Asthana., Karen Y Linde-Garelli., Lucy Artemis Xu., Leilani E Labrie., Mohammadamin Mobedi., Peter K Jackson.
Science advances 2025 Apr; 11(17):0.
Application:Immunofluorescence (IF), Human, hTERT-RPE-1 cells.
- A type of pancreatic cancer cells form cell clusters from a solitary condition in a primary ciliogenesis-dependent manner.
Kenji Shirakawa, Ryota Nakazato, Tetsuhiro Hara, Kenichiro Uemura, Faryal Ijaz, Shinya Takahashi, Koji Ikegami.
Medical Molecular Morphology 2025 Mar; 0:0.
Application:IF, Human, PANC-1 cell line.
- Myristoylated Neuronal Calcium Sensor-1 captures the preciliary vesicle at distal appendages.
Tomoharu Kanie, Roy Ng, Keene L Abbott, Niaj Mohammad Tanvir, Esben Lorentzen, Olaf Pongs, Peter K Jackson.
eLife 2025 Jan; 14:e85998.
Application:IF, Human, Mouse, RPE-1 cells, Kidney.
- A hierarchical pathway for assembly of the distal appendages that organize primary cilia.
Tomoharu Kanie., Beibei Liu., Julia F Love., Saxton D Fisher., Anna-Karin Gustavsson., Peter K Jackson.
eLife 2025 Jan; 0:14.
Application:Immunofluorescence, 3D single-molecule super-resolution imaging, Human, HTERT RPE-1 cells.
- Cyclin O controls entry into the cell-cycle variant required for multiciliated cell differentiation.
Michella Khoury Damaa, Jacques Serizay, Rémi Balagué, Amélie-Rose Boudjema, Marion Faucourt, Nathalie Delgehyr, Kim Jee Goh, Hao Lu, Ee Kim Tan, Cameron T James, Catherine Faucon, Rana Mitri, Diana Carolin Bracht, Colin D Bingle, Norris Ray Dunn, Sebastian J Arnold, Laure-Emmanuelle Zaragosi, Pascal Barbry, Romain Koszul, Heymut Omran, Gabriel Gil-Gómez, Estelle Escudier, Marie Legendre, Sudipto Roy, Nathalie Spassky, Alice Meunier.
Cell Reports 2025 Jan; 44(1):115117.
Application:IS, Mice, Brain lateral ventricles and tracheal samples.
- Cyclin switch tailors a cell cycle variant to orchestrate multiciliogenesis.
Jacques Serizay, Michella Khoury Damaa, Amélie-Rose Boudjema, Rémi Balagué, Marion Faucourt, Nathalie Delgehyr, Camille Noûs, Laure-Emmanuelle Zaragosi, Pascal Barbry, Nathalie Spassky, Romain Koszul, Alice Meunier.
Cell Reports 2025 Jan; 44(1):115103.
Application:IS, Mouse, Brain tissue.
- Primary cilia formation requires the Leigh syndrome–associated mitochondrial protein NDUFAF2.
Chien-Hui Lo, Zhiquan Liu, Siyu Chen, Frank Lin, Andrew R Berneshawi, Charles Q Yu, Euna B Koo, Tia J Kowal, Ke Ning, Yang Hu, Won-Jing Wang, Y Joyce Liao, Yang Sun.
J Clin Invest 2024 Jul; 134(13):e175560.
Application:IF, Human, RPE cell serum.
- Heterozygous FOXJ1 Mutations Cause Incomplete Ependymal Cell Differentiation and Communicating Hydrocephalus.
Connie C Hou, Danielle Li, Bethany C Berry, Shaokuan Zheng, Rona S Carroll, Mark D Johnson, Hong Wei Yang.
Cellular and Molecular Neurobiology 2023 Nov; 43(8):4013.
Application:IF, Mouse, Brain (Ventricle).
- Repurposing of the multiciliation gene regulatory network in fate specification of Cajal-Retzius neurons.
Matthieu X Moreau, Yoann Saillour, Vicente Elorriaga, Benoit Bouloudi, Elodie Delberghe, Tanya Deutsch Guerrero, Amaia Ochandorena-Saa, Laura Maeso-Alonso, Margarita M Marques, Maria C Marin, Nathalie Spassky, Alessandra Pierani, Frederic Causeret
Dev Cell 2023 Aug; 58(15):1365-1382..
- LRP2 contributes to planar cell polarity-dependent coordination of motile cilia function.
Lena Bunatyan, Anca Margineanu, Camille Boutin, Mireille Montcouquiol, Sebastian Bachmann, Erik Ilsø Christensen, Thomas E Willnow, Annabel Christ.
Cell and Tissue Research 2023 Feb; [Epub].
Application:IHC, Mouse, Mouse brain (ventricular lateral wall).
- A hierarchical pathway for assembly of the distal appendages that organize primary cilia.
Tomoharu Kanie, Julia F Love, Saxton D Fisher, Anna-Karin Gustavsson, Peter K Jackson.
bioRxiv : the Preprint Server for Biology 2023 Jan; [Epub].
Application:IF, Human, RPE cells.
- Myristoylated Neuronal Calcium Sensor-1 captures the ciliary vesicle at distal appendages.
Tomoharu Kanie, Roy Ng, Keene L Abbott, Olaf Pongs, Peter K Jackson.
bioRxiv : the Preprint Server for Biology 2023 Jan; [Epub].
Application:IF, Human, Mouse, Airway epithelia, Ependymal cells, Fibroblast, Hippocampus, Kidney, Pancrease, RPE cells, Retina .
- p53/p21 pathway activation contributes to the ependymal fate decision downstream of GemC1.
Gonzalo Ortiz-Álvarez, Aurélien Fortoul, Ayush Srivastava, Matthieu X Moreau, Benoît Bouloudi, Caroline Mailhes-Hamon, Nathalie Delgehyr, Marion Faucourt, Mathieu Bahin, Corinne Blugeon, Marielle Breau, Vincent Géli, Frédéric Causeret, Alice Meunier, Nathalie Spassky.
Cell Reports 2022 Dec; 41(11):111810.
Application:IF, Mouse, Embryonic brain, Ependymal cells, Ventricular-subventricular zone.
- Primary cilia on muscle stem cells are critical to maintain regenerative capacity and are lost during aging.
Adelaida R Palla, Keren I Hilgendorf, Ann V Yang, Jaclyn P Kerr, Aaron C Hinken, Janos Demeter, Peggy Kraft, Nancie A Mooney, Nora Yucel, David M Burns, Yu Xin Wang, Peter K Jackson, Helen M Blau.
Nature Communications 2022 Mar; 13(1):1439.
Application:IF, Mouse, Mouse myofibers, Mouse muscle stem cells.
- ARL3 and ARL13B GTPases participate in distinct steps of INPP5E targeting to the ciliary membrane.
Sayaka Fujisawa, Hantian Qiu, Shohei Nozaki, Shuhei Chiba, Yohei Katoh, Kazuhisa Nakayama.
Biology Open 2021 Sep; 10(9):bio058843.
Application:IF, Human, HEK 293T, RPE1 cells.
- Cooperation of the IFT-A complex with the IFT-B complex is required for ciliary retrograde protein trafficking and GPCR import.
Takuya Kobayashi, Yamato Ishida, Tomoaki Hirano, Yohei Katoh, Kazuhisa Nakayama.
Molecular Biology of the Cell 2021 Jan; 32(1):45.
Application:IF, Human, Human RPE.
- A Dual Protein-mRNA Localization Screen Reveals Compartmentalized Translation and Widespread Co-translational RNA Targeting.
Racha Chouaib, Adham Safieddine, Xavier Pichon, Arthur Imbert, Oh Sung Kwon, Aubin Samacoits, Abdel-Meneem Traboulsi, Marie-Cécile Robert, Nikolay Tsanov, Emeline Coleno, Ina Poser, Christophe Zimmer, Anthony Hyman, Hervé Le Hir, Kazem Zibara, Marion Peter, Florian Mueller, Thomas Walter, Edouard Bertrand.
Developmental Cell 2020 Sep; 54(6):773.
Application:IF, Human, HeLa cells.
- mTOR and S6K1 Drive Polycystic Kidney by the Control of Afadin-dependent Oriented Cell Division.
Martina Bonucci, Nicolas Kuperwasser, Serena Barbe, Vonda Koka, Delphine de Villeneuve, Chi Zhang, Nishit Srivastava, Xiaoying Jia, Matthew P Stokes, Frank Bienaimé, Virginie Verkarre, Jean Baptiste Lopez, Fanny Jaulin, Marco Pontoglio, Fabiola Terzi, Benedicte Delaval, Matthieu Piel, Mario Pende.
Nature Communications 2020 Jun; 11(1):3200.
Application:WB-Ti, Mouse, Mouse kidney.
- Adult Neural Stem Cells and Multiciliated Ependymal Cells Share a Common Lineage Regulated by the Geminin Family Members.
Ortiz-Álvarez G, Daclin M, Shihavuddin A, Lansade P, Fortoul A, Faucourt M, Clavreul S, Lalioti ME, Taraviras S, Hippenmeyer S, Livet J, Meunier A, Genovesio A, Spassky N.
Neuron 2019 Apr; 102(1):159.
Application:IF, IHC, Mouse, Mouse brains.
- Ependymal cilia beating induces an actin network to protect centrioles against shear stress.
Mahuzier A, Shihavuddin A, Fournier C, Lansade P, Faucourt M, Menezes N, Meunier A, Garfa-Traoré M, Carlier MF, Voituriez R, Genovesio A, Spassky N, Delgehyr N.
Nature Communications 2018 Jun; 9(1):2279.
Application:IF, Mouse, Mouse brain ventricles.
- Spatial Control of Primary Ciliogenesis by Subdistal Appendages Alters Sensation-Associated Properties of Cilia.
Gregory Mazo, Nadine Soplop, Won-Jing Wang, Kunihiro Uryu, Meng Fu Bryan Tsou.
Developmental Cell 2016 Nov; 39(4):424.
Application:IF, Human, RPE1 cells.
- A dual role for planar cell polarity genes in ciliated cells.
Boutin C, Labedan P, Dimidschstein J, Richard F, Cremer H, Andre P, Yang Y, Montcouquiol M, Goffinet AM, Tissir F.
PNAS 2014 Jul; 111(30):E3129.
Application:IS, Mouse, Ciliated cells.
- Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer.
Mano Y, Takahashi K, Ishikawa N, Takano A, Yasui W, Inai K, Nishimura H, Tsuchiya E, Nakamura Y, Daigo Y.
Cancer Science 2007 Sep; 98(12):1902.
Application:IF, WB, Human, Human lung cancer, A549, NCI-H522, NCI-H520, LC176, LC319 SAEC, SBC-5, SK-LU-1, SK-MES-1 cells.
- Enhanced release of ciliary extracellular vesicles suppresses cell migration and promotes cell aggregation.
FGFR1OP monoclonal antibody (M01), clone 2B1
Cat# H00011116-M01
Size : 100ug
Brand : Abnova
Images





