FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (FITC)
Cat# 126611-FITC-100ul
Size : 100ul
Brand : US Biological
126611-FITC FAM84A (Protein FAM84A, Neurologic Sensory Protein 1, NSE1, FLJ35392, PP11517) (FITC)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
BC026346; AAH26346Shipping Temp
Blue IceStorage Temp
-20°CFAM84A (Family with sequence similarity 84 member A) was identified in a screen for genes up-regulated in colon cancer. It may play a role in cell migration and has a critical role in the progression of colon cancer.
Applications:
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml
Optimal dilutions to be determined by the researcher.
AA Sequence:
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQHAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

