ETV5 Antibody - N-terminal region - Biotin
Cat# ARP31658_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
ETV5 Antibody - N-terminal region : Biotin (ARP31658_P050-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ETV5 (ARP31658_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ETV5 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 82% |
| Peptide Sequence | Synthetic peptide located within the following region: MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ETV5 (ARP31658_P050-Biotin) antibody is Catalog # AAP31658 (Previous Catalog # AAPP02445) |
| Reference | Helgeson,B.E., (2008) Cancer Res. 68 (1), 73-80 |
|---|---|
| Gene Symbol | ETV5 |
| Gene Full Name | Ets variant 5 |
| Alias Symbols | ERM |
| NCBI Gene Id | 2119 |
| Protein Name | ETS translocation variant 5 |
| Description of Target | ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer. |
| Uniprot ID | P41161 |
| Protein Accession # | NP_004445 |
| Nucleotide Accession # | NM_004454 |
| Protein Size (# AA) | 510 |
| Molecular Weight | 58kDa |
| Protein Interactions | RFWD2; HDAC11; DHRS7; SEZ6L2; SLC22A2; HOXD9; CYP3A5; CCR5; CISH; AMH; APP; BRCA1; ELAVL1; SUMO2; UBC; AR; |
