Envelope glycoprotein L Recombinant Protein
Cat# OPCA02978-100UG
Size : 100ug
Brand : Aviva Systems Biology
GL Recombinant Protein (HHV-5) (OPCA02978)
Datasheets/Manuals | Printable datasheet for GL Recombinant Protein (HHV-5) (OPCA02978) |
---|
Predicted Species Reactivity | Human Betaherpesvirus 5|Human cytomegalovirus|Human Herpesvirus 5 |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Peptide Sequence | AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR |
Source | Yeast |
Gene Symbol | UL115 |
---|---|
Gene Full Name | envelope glycoprotein L |
Alias Symbols | envelope glycoprotein L, HHV5wtgp101. |
NCBI Gene Id | 3077416 |
Protein Name | Envelope glycoprotein L |
Description of Target | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH. |
Uniprot ID | F5HCH8 |
Protein Size (# AA) | Full Length of Mature Protein |
Molecular Weight | 29.5 kDa |