Eif4ebp1 antibody - N-terminal region
Cat# ARP52033_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
Eif4ebp1 Antibody - N-terminal region (ARP52033_P050)
| Datasheets/Manuals | Printable datasheet for anti-Eif4ebp1 (ARP52033_P050) antibody |
|---|
| Tested Species Reactivity | Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: ALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTP |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Eif4ebp1 (ARP52033_P050) antibody is Catalog # AAP52033 |
| Gene Symbol | Eif4ebp1 |
|---|---|
| Gene Full Name | Eukaryotic translation initiation factor 4E binding protein 1 |
| Alias Symbols | PH, 4e-bp, 4e-bp1, PHAS-I, AA959816 |
| NCBI Gene Id | 13685 |
| Protein Name | Eukaryotic translation initiation factor 4E-binding protein 1 |
| Description of Target | Eif4ebp1 regulates eIF4E activity by preventing its assembly into the eIF4F complex. It mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. |
| Uniprot ID | Q60876 |
| Protein Accession # | NP_031944 |
| Nucleotide Accession # | NM_007918 |
| Protein Size (# AA) | 117 |
| Molecular Weight | 12kDa |
| Protein Interactions | RAD23B; Mapk1; Ubc; Eif4e; |
