- Specifications
Product Description
Mouse polyclonal antibody raised against a partial recombinant CRB1.
Immunogen
CRB1 (NP_036208, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Sequence
FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (73)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.1 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Recombinant protein)
ELISA
- Gene Info — CRB1
Entrez GeneID
23418GeneBank Accession#
NM_012076Protein Accession#
NP_036208Gene Name
CRB1
Gene Alias
LCA8, RP12
Gene Description
crumbs homolog 1 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternatively spliced transcript variants have been observed but their full-length nature has yet to be determined. [provided by RefSeq
Other Designations
OTTHUMP00000033690|crumbs homolog 1
- Interactomes
- Diseases
- Publication Reference
- Human CRB1 and CRB2 form homo- and heteromeric protein complexes in the retina.
Isabel F Stehle, Joel A Imventarza, Franziska Woerz, Felix Hoffmann, Karsten Boldt, Tina Beyer, Peter Mj Quinn, Marius Ueffing.
Life Science Alliance 2024 Apr; 7(6):e202302440.
Application:IF, Human, Retina, hiPSC-derived retinal organoids.
- Characterization and AAV-mediated CRB gene augmentation in human-derived CRB1KO and CRB1KOCRB2+/- retinal organoids.
Nanda Boon, Xuefei Lu, Charlotte A Andriessen, Michaela Orlovà, Peter M J Quinn, Camiel J F Boon, Jan Wijnholds.
Molecular Therapy. Methods & Clinical Development 2023 Oct; 31:101128.
Application:IHC, Human, Retinal organoids.
- AAV-mediated gene augmentation therapy of CRB1 patient-derived retinal organoids restores the histological and transcriptional retinal phenotype.
Nanda Boon, Xuefei Lu, Charlotte A Andriessen, Ioannis Moustakas, Thilo M Buck, Christian Freund, Christiaan H Arendzen, Stefan Böhringer, Hailiang Mei, Jan Wijnholds.
Stem Cell Reports 2023 May; 18(5):1123.
Application:IF, Human, Human retinal organoid.
- Overexpression of Human CRB1 or Related Isoforms, CRB2 and CRB3, Does Not Regulate the Human Presenilin Complex in Culture Cells.
Pardossi-Piquard R, Chen F, Silva-Gagliardi NF, Szego M, McInnes R, McGlade CJ, George-Hyslop PS, Fraser PE.
Biochemistry 2007 Nov; 46(48):13704.
Application:IP-WB, Human, HEK 293 cells, Human retina tissue.
- Human CRB1 and CRB2 form homo- and heteromeric protein complexes in the retina.
CRB1 polyclonal antibody (A01)
Cat# H00023418-A01
Size : 50uL
Brand : Abnova
Images