COQ8A Antibody - C-terminal region - FITC
Cat# ARP48386_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
COQ8A Antibody - C-terminal region : FITC (ARP48386_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-COQ8A (ARP48386_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human ADCK3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: LVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-COQ8A (ARP48386_P050-FITC) antibody is Catalog # AAP48386 |
| Gene Symbol | COQ8A |
|---|---|
| Gene Full Name | coenzyme Q8A |
| Alias Symbols | COQ8, ADCK3, ARCA2, CABC1, SCAR9, COQ10D4 |
| NCBI Gene Id | 56997 |
| Protein Name | atypical kinase COQ8A, mitochondrial |
| Description of Target | This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. |
| Uniprot ID | Q8NI60 |
| Protein Accession # | NP_064632.2 |
| Nucleotide Accession # | NM_020247.4 |
| Protein Size (# AA) | 492 |
| Molecular Weight | 54kDa |