CD36 Antibody - N-terminal region - Biotin
Cat# ARP48129_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
CD36 Antibody - N-terminal region : Biotin (ARP48129_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-CD36 (ARP48129_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Additional Information | IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.0 ug/ml. Gel concentration: 12%. |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CD36 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 79%; Dog: 79%; Goat: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 79%; Rat: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CD36 (ARP48129_P050-Biotin) antibody is Catalog # AAP48129 (Previous Catalog # AAPP28012) |
| Reference | Ozer,N.K., (2006) Atherosclerosis 184 (1), 15-20 |
|---|---|
| Gene Symbol | CD36 |
| Gene Full Name | CD36 molecule (thrombospondin receptor) |
| Alias Symbols | FAT, GP4, GP3B, GPIV, CHDS7, PASIV, SCARB3, BDPLT10 |
| NCBI Gene Id | 948 |
| Protein Name | Platelet glycoprotein 4 |
| Description of Target | CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Three alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. |
| Uniprot ID | P16671 |
| Protein Accession # | NP_001001547 |
| Nucleotide Accession # | NM_001001547 |
| Protein Size (# AA) | 472 |
| Molecular Weight | 53kDa |
| Protein Interactions | CHRD; APP; CAND1; ITGA2B; MATK; SRC; THBS1; ITGB3; LYN; YES1; ITGA6; CD9; FYN; ITGB1; COL1A2; COL1A1; VLDLR; LDLR; HSD11B1; |
