Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO)
Cat# NB-64-49735-20ug
Size : 20ug
Brand : Neo Biotech
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. Cathelicidin antimicrobial peptide Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 24.7 kDa and the accession number is P49913. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-10xHis-SUMO, C-Myc |
| Accession Number | P49913 |
| Synonyms | FALL39,Cathelicidin antimicrobial peptide,CAP18,CAMP,18 kDa cationic antimicrobial protein (CAP-18;hCAP-18) |
| Amino Acid | FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Construction | 132-170 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 24.7 kDa (predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Research Background | Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity. |
Dose Conversion
You can also refer to dose conversion for different animals. More

