Reagents and instruments for immunology, cell biology and molecular biology.
 
> beta Actin (ACTB) (NM_001101) Human Recombinant Protein

beta Actin (ACTB) (NM_001101) Human Recombinant Protein

Print Print
Please log in

Cat# TP303643

Size : 20ug

Contact local distributor :


Phone :

beta Actin (ACTB) (NM_001101) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303643
Recombinant protein of human actin, beta (ACTB), 20 µg
 

Other products for "beta Actin or NM_001101"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203643 representing NM_001101
Red=Cloning site Green=Tags(s)

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP
IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVL
SLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR
DIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFN
SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS
TFQQMWISKQEYDESGPSIVHRKCF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.6 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001092
Locus ID 60
UniProt ID P60709
Cytogenetics 7p22.1
RefSeq Size 1793
RefSeq ORF 1125
Synonyms BRWS1; PS1TP5BP1
Summary This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins that are ubiquitously expressed. Mutations in this gene cause Baraitser-Winter syndrome 1, which is characterized by intellectual disability with a distinctive facial appearance in human patients. Numerous pseudogenes of this gene have been identified throughout the human genome. provided by RefSeq, Aug 2017
Protein Categories ADC Targets, Intracellular Proteins
Protein Families ES Cell Differentiation/IPS
Protein Pathways Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis
FAQs
  • Protein FAQs
SDS
SKU Description Size
PH303643 ACTB MS Standard C13 and N15-labeled recombinant protein (NP_001092) 10 ug
LC420311 Lyophilized ACTB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY420311 Transient overexpression lysate of actin, beta (ACTB) (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT