AKR1B1 Antibody - N-terminal region - FITC
Cat# ARP48179_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
AKR1B1 Antibody - N-terminal region : FITC (ARP48179_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-AKR1B1 (ARP48179_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AKR1B1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 86%; Zebrafish: 91% |
| Peptide Sequence | Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AKR1B1 (ARP48179_P050-FITC) antibody is Catalog # AAP48179 (Previous Catalog # AAPP28688) |
| Reference | Steuber,H., (2008) J. Mol. Biol. 379 (5), 991-1016 |
|---|---|
| Gene Symbol | AKR1B1 |
| Gene Full Name | Aldo-keto reductase family 1, member B1 (aldose reductase) |
| Alias Symbols | AR, ADR, ALR2, ALDR1 |
| NCBI Gene Id | 231 |
| Protein Name | Aldose reductase |
| Description of Target | AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P15121 |
| Protein Accession # | NP_001619 |
| Nucleotide Accession # | NM_001628 |
| Protein Size (# AA) | 316 |
| Molecular Weight | 36kDa |
| Protein Interactions | UBC; ASB18; ASB9; ASB5; SMAD1; SORD; SHBG; TFE3; |
