Adrenocorticotropic hormone TFA
Cat# NB-64-41385-50mg
Size : 50mg
Brand : Neo Biotech
Adrenocorticotropic hormone TFA (Synonyms: Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticot...)
Catalog No. T73664 Copy Product Info
Purity: 99.71%
Adrenocorticotropic hormone TFA is an adrenocorticotropic hormone secreted by the anterior pituitary gland and is involved in the neurohormonal regulation of the body.Adrenocorticotropic hormone TFA is often used as a health indicator in blood tests.
Adrenocorticotropic hormone TFA
Copy Product InfoSynonyms Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticotrophic hormone TFA, ACTH TFA
Adrenocorticotropic hormone TFA is an adrenocorticotropic hormone secreted by the anterior pituitary gland and is involved in the neurohormonal regulation of the body.Adrenocorticotropic hormone TFA is often used as a health indicator in blood tests.
Adrenocorticotropic hormone TFA
Select Batch
Purity:99.71%
Appearance:Solid
Color:White
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Adrenocorticotropic hormone TFA is an adrenocorticotropic hormone secreted by the anterior pituitary gland and is involved in the neurohormonal regulation of the body.Adrenocorticotropic hormone TFA is often used as a health indicator in blood tests. |
| Synonyms | Adrenocorticotropic hormone TFA(9002-60-2 free base), Adrenocorticotrophic hormone TFA, ACTH TFA |
| Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 40 mg/mL, Sonication is recommended. |

