ABAT antibody - middle region
Cat# ARP51765_P050
Size : 100ul
Brand : Aviva Systems Biology
ABAT Antibody - middle region (ARP51765_P050)
| Datasheets/Manuals | Printable datasheet for anti-ABAT (ARP51765_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ABAT |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Goat: 77%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ABAT (ARP51765_P050) antibody is Catalog # AAP51765 (Previous Catalog # AAPP40140) |
| Reference | Inada,T., (2008) Pharmacogenet. Genomics 18 (4), 317-323 |
|---|---|
| Gene Symbol | ABAT |
| Gene Full Name | 4-aminobutyrate aminotransferase |
| Alias Symbols | GABAT, NPD009, GABA-AT |
| NCBI Gene Id | 18 |
| Protein Name | 4-aminobutyrate aminotransferase, mitochondrial |
| Description of Target | 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50-kD subunits complexed to pyridoxal-5-phosphate. The protein sequence is over 95% similar to the pig protein. GABA is estimated to be present in nearly one-third of human synapses. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. |
| Uniprot ID | P80404 |
| Protein Accession # | NP_065737 |
| Nucleotide Accession # | NM_020686 |
| Protein Size (# AA) | 500 |
| Molecular Weight | 56kDa |
| Protein Interactions | LGR4; BAG3; ALDH5A1; ABAT; |




