Abaecin acetate
Cat# NB-64-43658-25mg
Size : 25mg
Brand : Neo Biotech
Abaecin acetate (Synonyms: Abaecin acetate(123997-18-2 Free base))
Catalog No. T80395L Copy Product Info
Purity: 96.92%
Abaecin acetate is a proline-enriched cationic peptide with broad-spectrum antimicrobial activity derived from the honeybee Apis mellifera.Abaecin acetate inhibits the growth of Escherichia coli in vitro.
Abaecin acetate
Copy Product InfoSynonyms Abaecin acetate(123997-18-2 Free base)
Abaecin acetate is a proline-enriched cationic peptide with broad-spectrum antimicrobial activity derived from the honeybee Apis mellifera.Abaecin acetate inhibits the growth of Escherichia coli in vitro.
Abaecin acetate
Select Batch
Purity:96.92%
Appearance:Solid
Color:White
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Abaecin acetate is a proline-enriched cationic peptide with broad-spectrum antimicrobial activity derived from the honeybee Apis mellifera.Abaecin acetate inhibits the growth of Escherichia coli in vitro. |
| Synonyms | Abaecin acetate(123997-18-2 Free base) |
| Sequence | Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr |
| Sequence Short | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |

