Wnt1 Antibody - C-terminal region - HRP
Cat# ARP32123_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
Wnt1 Antibody - C-terminal region : HRP (ARP32123_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-WNT1 (ARP32123_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Wnt1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-WNT1 (ARP32123_P050-HRP) antibody is Catalog # AAP32123 |
| Gene Symbol | Wnt1 |
|---|---|
| Gene Full Name | wingless-type MMTV integration site family, member 1 |
| Alias Symbols | sw, Int, Wnt-, Int-1, Wnt-1, swaying |
| NCBI Gene Id | 22408 |
| Protein Name | Proto-oncogene Wnt-1 |
| Description of Target | Wnt1 is a ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, it is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. It is a probable developmental protein and may be a signaling molecule important in CNS development. Wnt1 is likely to signal over only few cell diameters. It ha s a proeminent role in the induction of the mesencephalon and cerebellum. It may play a crucial role in the morphogenesis of the neural tube and/or the early stages of CNS development. It has a role in osteoblast function and bone development. |
| Uniprot ID | P04426 |
| Protein Accession # | NP_067254 |
| Nucleotide Accession # | NM_021279 |
| Protein Size (# AA) | 370 |
| Molecular Weight | 40kDa |
| Protein Interactions | lrp6-b; Lrp6; Wnt3a; Porcn; Ryk; Lrp5; Fzd8; Fzd1; Dkk1; |
