VACWR034, Recombinant, Vaccinia Virus, aa1-88, His-Tag (Protein K3)

Print

Cat# 375803-20ug

Size : 20ug

Contact local distributor :

Phone : +1 850 650 7790

Brand : US Biological

Request more information

Contact local distributor :

Phone : +1 850 650 7790

375803 VACWR034, Recombinant, Vaccinia Virus, aa1-88, His-Tag (Protein K3)

Swiss Prot

P18378

Grade

Purified

Shipping Temp

Blue Ice

Storage Temp

-20°C

Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.

Source:
Recombinant protein corresponding to aa1-88 from vaccinia virus Protein K3, fused to His-Tag at N-terminal, expressed in Yeast.

Molecular Weight:
~12.6kD

Amino Acid Sequence:
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications

Source: Recombinant, Yeast|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Form

Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.

Purity

≥90% (SDS-PAGE)

References

1. "Recombinant vaccinia virus K3L gene product prevents activation of double-stranded RNA-dependent, initiation factor 2 alpha-specific protein kinase." Carroll K., Elroy-Stein O., Moss B., Jagus R.J. Biol. Chem. 268:12837-12842(1993).