USP16 (NM_006447) Human Recombinant Protein

Cat# TP322609

Size : 20ug

Contact local distributor :


Phone :

USP16 (NM_006447) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP322609
Recombinant protein of human ubiquitin specific peptidase 16 (USP16), transcript variant 1, 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222609 representing NM_006447
Red=Cloning site Green=Tags(s)

MGKKRTKGKTVPIDDSSETLEPVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPS
VWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRK
QASITTPKPAEKDNGNIELENKKLEKESKNEQEREKKENMAKENPPMNSPCQITVKGLSNLGNTCFFNAV
MQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGVVTPKE
LFSQVCKKAVRFKGYQQQDSQELLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKS
MPSFVDRIFGGELTSMIMCDQCRTVSLVHESFLDLSLPVLDDQSGKKSVNDKNLKKTVEDEDQDSEEEKD
NDSYIKERSDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDSEYEAEMSLQGE
VNIKSNHISQEGVMHKEYCVNQKDLNGQAKMIESVTDNQKSTEEVDMKNINMDNDLEVLTSSPTRNLNGA
YLTEGSNGEVDISNGFKNLNLNAALHPDEINIEILNDSHTPGTKVYEVVNEDPETAFCTLANREVFNTDE
CSIQHCLYQFTRNEKLRDANKLLCEVCTRRQCNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRF
QQAGFNLRKVNKHIKFPEILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARTANS
HLSNLVLHGDIPQDFEMESKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERIL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 93.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006438
Locus ID 10600
UniProt ID Q9Y5T5
Cytogenetics 21q21.3
RefSeq Size 2989
RefSeq ORF 2469
Synonyms UBP-M; UBPM
Summary This gene encodes a deubiquitinating enzyme that is phosphorylated at the onset of mitosis and then dephosphorylated at the metaphase/anaphase transition. It can deubiquitinate H2A, one of two major ubiquitinated proteins of chromatin, in vitro and a mutant form of the protein was shown to block cell division. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. provided by RefSeq, Jul 2008
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Protease
SKU Description Size
PH322609 USP16 MS Standard C13 and N15-labeled recombinant protein (NP_006438) 10 ug
LC416633 Lyophilized USP16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC422330 Lyophilized USP16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC424308 Lyophilized USP16 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY416633 Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 1 (as WB positive control) 100 ug
LY422330 Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 3 (as WB positive control) 100 ug
LY424308 Transient overexpression lysate of ubiquitin specific peptidase 16 (USP16), transcript variant 2 (as WB positive control) 100 ug
TP762091 Purified recombinant protein of Human ubiquitin specific peptidase 16 (USP16), transcript variant 2,Met1-Asp355, with N-terminal His tag, expressed in E. coli, 50ug 50 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT