TIGIT (NM_173799) Human Recombinant Protein

Cat# TP321447

Size : 20ug

Contact local distributor :


Phone :

TIGIT (NM_173799) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP321447
Recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221447 protein sequence
Red=Cloning site Green=Tags(s)

MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN
ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI
PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL
CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_776160
Locus ID 201633
UniProt ID Q495A1
Cytogenetics 3q13.31
RefSeq Size 2978
RefSeq ORF 732
Synonyms VSIG9; VSTM3; WUCAM
Summary This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.provided by RefSeq, Sep 2009
Protein Categories ADC Targets, Membrane Proteins
Protein Families Transmembrane
SKU Description Size
PH321447 TIGIT MS Standard C13 and N15-labeled recombinant protein (NP_776160) 10 ug
LC406575 Lyophilized TIGIT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY406575 Transient overexpression lysate of T cell immunoreceptor with Ig and ITIM domains (TIGIT) (as WB positive control) 100 ug
TP700214 Purified recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
TP723994 Recombinant human TIGIT Protein with C-terminal human Fc tag 100 ug
TP724032 Recombinant human TIGIT Protein with C-terminal mouse Fc tag 100 ug
TP724033 Recombinant human TIGIT Protein with C-terminal His tag 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
0102-09
 100tests