Reagents and instruments for immunology, cell biology and molecular biology.
 
> SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4

SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4

Print Print
Please log in

Cat# MBS6402704-0,1mL

Size : 0.1mL

Brand : MyBiosource

Contact local distributor :


Phone : +1 850 650 7790
SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4

SLC38A4 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6402704

MBS6402704 is an antibody targeting SLC38A4. Also known as SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter… More details

Product Overview

Online Datasheet in PDF
Product Name
SLC38A4, Polyclonal Antibody
Full Product Name
SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4
Product Gene Name
anti-SLC38A4 antibody
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat, Canine, C. elegans, Drosophila, Zebrafish
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes SLC38A4. Species Crossreactivity: Human, mouse, rat, canine, c. elegans, drosophila, and zebrafish.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Reconstituted product is stable for 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Middle region of SLC38A4 corresponding to LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV
Conjugate
AP
Note
Preservative Free

Product Categories/Family for anti-SLC38A4 antibody

Antibodies; Ion Channel
Applications Tested/Suitable for anti-SLC38A4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-SLC38A4 antibody
IHC: 4-8ug/ml
WB: 2.5ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SLC38A4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SLC38A4. It may not necessarily be applicable to this product.

Protein Family
Sodium-coupled neutral amino acid transporter

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.