RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S Ribosomal Protein L35)
Cat# 375128-100ug
Size : 100ug
Brand : US Biological
375128 RpmI, Recombinant, E. coli, aa7-65, GST-Tag (50S Ribosomal Protein L35)
Swiss Prot
P0A7Q1Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°C
Source:
Recombinant protein corresponding to aa7-64 from E. coli 50S Ribosomal Protein L35, fused to GST-Tag at N-terminal, expressed in E. coli.
Molecular Weight:
~33.5kD
Amino Acid Sequence:
VRGAAKRFKKTGKGGFKHKHANLRHILTKKATKRKRHLRPKAMVSKGDLGLVIACLPY
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥90% (SDS-PAGE)

