RFC2 Antibody - N-terminal region - FITC
Cat# ARP61588_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
RFC2 Antibody - N-terminal region : FITC (ARP61588_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-RFC2 (ARP61588_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: APGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-RFC2 (ARP61588_P050-FITC) antibody is Catalog # AAP61588 (Previous Catalog # AAPP47695) |
| Subunit | 2 |
| Gene Symbol | RFC2 |
|---|---|
| Gene Full Name | Replication factor C (activator 1) 2, 40kDa |
| Alias Symbols | RFC40 |
| NCBI Gene Id | 5982 |
| Protein Name | Putative uncharacterized protein RFC2 EMBL AAP22335.1 |
| Description of Target | The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also called activator 1, is a protein complex consisting of five distinct subunits of 145, 40, 38, 37, and 36.5 kD. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP. Deletion of this gene has been associated with Williams syndrome. |
| Uniprot ID | Q75MT5 |
| Protein Accession # | NP_002905 |
| Nucleotide Accession # | NM_002914 |
| Protein Size (# AA) | 320 |
| Molecular Weight | 35kDa |
| Protein Interactions | CEP76; SUMO2; PCNA; UBC; RPA3; RPA2; RPA1; C14orf166; RTCB; LRRFIP1; PRKDC; KRT18; FLII; DDX1; RFC4; PRKAR1A; PAXIP1; MDC1; TP53BP1; ECT2; BRCA1; BARD1; CHTF18; RFC5; RFC3; RFC1; PURA; NEDD8; RAD18; CAND1; COPS5; CUL3; SMARCAD1; MYC; tat; DDX11; CHD1L; PM |