RBPJK (RBPJ) (NM_203283) Human Recombinant Protein

Cat# TP304791

Size : 20ug

Contact local distributor :


Phone :

RBPJK (RBPJ) (NM_203283) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304791
Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3, 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204791 protein sequence
Red=Cloning site Green=Tags(s)

MGGCRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKE
QMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGV
FLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLL
DDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTER
MYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGG
GDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGII
YSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_976028
Locus ID 3516
UniProt ID Q06330
Cytogenetics 4p15.2
RefSeq Size 5762
RefSeq ORF 1455
Synonyms AOS3; CBF-1; CBF1; csl; IGKJRB; IGKJRB1; KBF2; RBP-J; RBP-JK; RBP-J kappa; RBPJK; RBPSUH; SUH
Summary The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9. provided by RefSeq, Oct 2013
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Protein Pathways Notch signaling pathway
SKU Description Size
PH304791 RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976028) 10 ug
PH309094 RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976029) 10 ug
LC401647 Lyophilized RBPJ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC404367 Lyophilized RBPJ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC404368 Lyophilized RBPJ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY401647 Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1 (as WB positive control) 100 ug
LY404367 Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3 (as WB positive control) 100 ug
LY404368 Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4 (as WB positive control) 100 ug
TP309094 Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4, 20 µg 20 ug
TP760429 Purified recombinant protein of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products