RAPGEF3 antibody - middle region

Cat# ARP52140_P050

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

RAPGEF3 Antibody - middle region (ARP52140_P050)

Datasheets/ManualsPrintable datasheet for anti-RAPGEF3 (ARP52140_P050) antibody
Product Info
Publications

Absence of EPAC1 Signaling to Stabilize CFTR in Intestinal Organoids

Authors: Ferreira, J. F., Silva, I., et al.

Journal: Cells. 11 (2022)

Cytoskeleton regulators CAPZA2 and INF2 associate with CFTR to control its plasma membrane levels under EPAC1 activation

Authors: Santos, J. D., Pinto, F. R., et al.

Journal: Biochem J. 477, 2561-2580 (2020)

EPAC1 activation by cAMP stabilizes CFTR at the membrane by promoting its interaction with NHERF1

Authors: Lobo, M. J., Quaresma, M. C., et al.

Journal: J Cell Sci. 129, 2599-612 (2016)

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RAPGEF3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 85%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
Concentration0.5 mg/ml
Blocking PeptideFor anti-RAPGEF3 (ARP52140_P050) antibody is Catalog # AAP52140 (Previous Catalog # AAPP42819)
Gene SymbolRAPGEF3
Gene Full NameRap guanine nucleotide exchange factor (GEF) 3
Alias SymbolsEPAC, EPAC1, bcm910, HSU79275, CAMP-GEFI
NCBI Gene Id10411
Protein NameRap guanine nucleotide exchange factor 3
Description of TargetThe function of the protein remains unknown.
Uniprot IDO95398
Protein Accession #NP_001092001
Nucleotide Accession #NM_001098531
Protein Size (# AA)923
Molecular Weight104kDa
Protein InteractionsPNMA1; AP2B1; NUP205; RAPGEF3; RANBP2; RAN; NUP98; KPNB1; MAP1A; RRAS2; RAP2A; RAP1A;