RAPGEF3 antibody - middle region
Cat# ARP52140_P050
Size : 100ul
Brand : Aviva Systems Biology
RAPGEF3 Antibody - middle region (ARP52140_P050)
| Datasheets/Manuals | Printable datasheet for anti-RAPGEF3 (ARP52140_P050) antibody |
|---|
| Publications | Absence of EPAC1 Signaling to Stabilize CFTR in Intestinal Organoids Cytoskeleton regulators CAPZA2 and INF2 associate with CFTR to control its plasma membrane levels under EPAC1 activation EPAC1 activation by cAMP stabilizes CFTR at the membrane by promoting its interaction with NHERF1 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAPGEF3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 85%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-RAPGEF3 (ARP52140_P050) antibody is Catalog # AAP52140 (Previous Catalog # AAPP42819) |
| Gene Symbol | RAPGEF3 |
|---|---|
| Gene Full Name | Rap guanine nucleotide exchange factor (GEF) 3 |
| Alias Symbols | EPAC, EPAC1, bcm910, HSU79275, CAMP-GEFI |
| NCBI Gene Id | 10411 |
| Protein Name | Rap guanine nucleotide exchange factor 3 |
| Description of Target | The function of the protein remains unknown. |
| Uniprot ID | O95398 |
| Protein Accession # | NP_001092001 |
| Nucleotide Accession # | NM_001098531 |
| Protein Size (# AA) | 923 |
| Molecular Weight | 104kDa |
| Protein Interactions | PNMA1; AP2B1; NUP205; RAPGEF3; RANBP2; RAN; NUP98; KPNB1; MAP1A; RRAS2; RAP2A; RAP1A; |




