PANX2 antibody - N-terminal region

Cat# ARP42778_T100

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

PANX2 Antibody - N-terminal region (ARP42778_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-PANX2 (ARP42778_T100) antibody
Product Info
Publications

Pannexin 2 is expressed in murine skin and promotes UVB-induced apoptosis of keratinocytes

Authors: Sanchez-Pupo, R. E., O'Donnell, B. L., et al.

Journal: Mol Biol Cell. 33, ar24 (2022)

Human stem cells express pannexins

Authors: Hainz, N., Beckmann, A., et al.

Journal: BMC Res Notes. 11, 54 (2018)

Manipulation of Panx1 Activity Increases the Engraftment of Transplanted Lacrimal Gland Epithelial Progenitor Cells

Authors: Basova, L. V., Tang, X., et al.

Journal: Invest Ophthalmol Vis Sci. 58, 5654-5665 (2017)

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PANX2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA
Concentration1.0 mg/ml
Blocking PeptideFor anti-PANX2 (ARP42778_T100) antibody is Catalog # AAP42778 (Previous Catalog # AAPS10104)
Enhanced Validation
Relative Expression (Western Blot)
Avivasheild
ReferenceBaranova,A., (2004) Genomics 83 (4), 706-716
Gene SymbolPANX2
Gene Full NamePannexin 2
Alias SymbolsPX2, hPANX2
NCBI Gene Id56666
Protein NamePannexin-2
Description of TargetPANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.
Uniprot IDQ96RD6
Protein Accession #NP_443071
Nucleotide Accession #NM_052839
Protein Size (# AA)633
Molecular Weight74 kDa

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT