ORF3 Recombinant Protein
Cat# OPCA02211-1MG
Size : 1mg
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
ORF3 Recombinant Protein (Hepatitis E virus genotype 1) (OPCA02211)
| Datasheets/Manuals | Printable datasheet for ORF3 Recombinant Protein (Hepatitis E virus genotype 1) (OPCA02211) |
|---|
| Predicted Species Reactivity | Hepatitis E virus|Hepatitis E Virus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Hepatitis E virus genotype 1 |
| Additional Information | Relevance: May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR |
| Protein Sequence | MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-114 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | The ORF3 protein of hepatitis E virus interacts with hemopexin by means of its 26 amino acid N-terminal hydrophobic domain II.Ratra R., Kar-Roy A., Lal S.K.Biochemistry 47:1957-1969(2008) |
|---|---|
| Gene Symbol | ORF3 |
| Alias Symbols | ORF3, Protein ORF3, pORF3 |
| Protein Name | Protein ORF3 |
| Description of Target | May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte. |
| Uniprot ID | O90299 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 27.8 kDa |
