mt2 Recombinant Protein
Cat# OPCA03101-100UG
Size : 100ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
MT2 Recombinant Protein (Zebrafish) (OPCA03101)
| Datasheets/Manuals | Printable datasheet for MT2 Recombinant Protein (Zebrafish) (OPCA03101) |
|---|
| Predicted Species Reactivity | Danio rerio|Zebrafish |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ |
| Source | Yeast |
| Gene Symbol | mt2 |
|---|---|
| Gene Full Name | metallothionein 2 |
| Alias Symbols | metallothionein A, metallothionein IIA, metallothionein IIB, metallothionein-1, metallothionein-2, mt, MT-2, mt1, wu:fc77e11, wu:fj10c11. |
| NCBI Gene Id | 100174951 |
| Protein Name | Metallothionein-2 |
| Description of Target | Metallothioneins have a high content of cysteine residues that bind various heavy metals. |
| Uniprot ID | Q7ZSY6 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 8 kDa |