MRTO4 antibody - N-terminal region
Cat# ARP46240_T100
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
MRTO4 Antibody - N-terminal region (ARP46240_T100)
| Datasheets/Manuals | Printable datasheet for anti-MRTO4 (ARP46240_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MRTO4 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 90%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-MRTO4 (ARP46240_T100) antibody is Catalog # AAP46240 (Previous Catalog # AAPP27072) |
| Sample Type Confirmation | MRTO4 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Gregory,S.G., (2006) Nature 441 (7091), 315-321 |
|---|---|
| Gene Symbol | MRTO4 |
| Gene Full Name | MRNA turnover 4 homolog (S. cerevisiae) |
| Alias Symbols | MRT4, C1orf33, dJ657E11.4 |
| NCBI Gene Id | 51154 |
| Protein Name | mRNA turnover protein 4 homolog |
| Description of Target | MRTO4 is a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly. |
| Uniprot ID | Q9UKD2 |
| Protein Accession # | NP_057267 |
| Nucleotide Accession # | NM_016183 |
| Protein Size (# AA) | 239 |
| Molecular Weight | 27kDa |
| Protein Interactions | SUMO2; UBC; GTPBP4; ADARB1; RNF2; BMI1; FN1; RPL31; FBL; FTSJ3; VAPA; XPO5; RSL24D1; NMD3; XPO1; RPL23A; GRK5; CAND1; CUL2; CUL3; TERF2IP; SIRT7; CEBPA; HDGF; Mki67; RARA; PML; MRT4; |
