lptD Recombinant Protein
Cat# OPCA03238-20UG
Size : 20ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
LPTD Recombinant Protein (Salmonella typhi) (OPCA03238)
| Datasheets/Manuals | Printable datasheet for LPTD Recombinant Protein (Salmonella typhi) (OPCA03238) |
|---|
| Predicted Species Reactivity | Salmonella enterica|Salmonella typhi |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS |
| Source | Yeast |
| Gene Symbol | STY0108 |
|---|---|
| Gene Full Name | organic solvent tolerance protein |
| Alias Symbols | imp, STY0108. |
| NCBI Gene Id | 1246607 |
| Protein Name | LPS-assembly protein LptD |
| Description of Target | Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane. |
| Uniprot ID | Q8Z9J6 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 12.9 kDa |