LMP1 Recombinant Protein
Cat# OPCA02861-100UG
Size : 100ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
LMP1 Recombinant Protein (HHV-4) (OPCA02861)
| Datasheets/Manuals | Printable datasheet for LMP1 Recombinant Protein (HHV-4) (OPCA02861) |
|---|
| Predicted Species Reactivity | Epstein-Barr virus|Epstein-Barr Virus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD |
| Source | Yeast |
| Alias Symbols | Protein p63. |
|---|---|
| Protein Name | Latent membrane protein 1 |
| Description of Target | Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. |
| Uniprot ID | P13198 |
| Protein Size (# AA) | Cytoplasmic Domain |
| Molecular Weight | 23 kda |