IL2RB Antibody - C-terminal region - FITC
Cat# ARP61193_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
IL2RB Antibody - C-terminal region : FITC (ARP61193_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-IL2RB (ARP61193_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Rat, Yeast |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Rat: 77%; Yeast: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: QGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-IL2RB (ARP61193_P050-FITC) antibody is Catalog # AAP61193 |
| Subunit | beta |
| Gene Symbol | IL2RB |
|---|---|
| Gene Full Name | Interleukin 2 receptor, beta |
| Alias Symbols | CD122, IMD63, IL15RB, P70-75 |
| NCBI Gene Id | 3560 |
| Protein Name | Interleukin-2 receptor subunit beta |
| Description of Target | The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. |
| Uniprot ID | P14784 |
| Protein Accession # | NP_000869 |
| Nucleotide Accession # | NM_000878 |
| Protein Size (# AA) | 551 |
| Molecular Weight | 58kDa |
| Protein Interactions | ECM1; JAK1; SOCS3; LCK; NEDD4; HGS; UBC; EIF3B; STAT5B; SOCS1; CISH; STAT5A; IL15RA; SHC1; STAT1; IL15; SHB; JAK3; SYK; IL2RG; GNB2L1; PTPN6; PIK3R1; LYN; RAF1; IL2RA; IL2; FYN; GRB2; STAT3; JAK2; |
