HMGCS2 antibody - N-terminal region
Cat# ARP41562_T100
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
HMGCS2 Antibody - N-terminal region (ARP41562_T100)
| Datasheets/Manuals | Printable datasheet for anti-HMGCS2 (ARP41562_T100) antibody |
|---|
| Publications | Possible role of intestinal fatty acid oxidation in the eating-inhibitory effect of the PPAR-α agonist Wy-14643 in high-fat diet fed rats Diacylglycerol acyltransferase-1 inhibition enhances intestinal fatty acid oxidation and reduces energy intake in rats |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCS2 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-HMGCS2 (ARP41562_T100) antibody is Catalog # AAP41562 (Previous Catalog # AAPP24247) |
| Reference | Bouchard,L., (2001) Pediatr. Res. 49 (3), 326-331 |
|---|---|
| Gene Symbol | HMGCS2 |
| Gene Full Name | 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) |
| NCBI Gene Id | 3158 |
| Protein Name | Hydroxymethylglutaryl-CoA synthase, mitochondrial |
| Description of Target | HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase. |
| Uniprot ID | P54868 |
| Protein Accession # | NP_005509 |
| Nucleotide Accession # | NM_005518 |
| Protein Size (# AA) | 508 |
| Molecular Weight | 56kDa |
| Protein Interactions | UBC; APP; YWHAQ; |
