HCFC2 Antibody - C-terminal region - Biotin
Cat# ARP31920_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
HCFC2 Antibody - C-terminal region : Biotin (ARP31920_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-HCFC2 (ARP31920_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HCFC2 |
| Purification | Affinity purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75% |
| Peptide Sequence | Synthetic peptide located within the following region: RIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRW |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HCFC2 (ARP31920_P050-Biotin) antibody is Catalog # AAP31920 |
| Reference | N/A |
|---|---|
| Gene Symbol | HCFC2 |
| Gene Full Name | host cell factor C2 |
| Alias Symbols | HCF2, HCF-2 |
| NCBI Gene Id | 29915 |
| Protein Name | Host cell factor 2 |
| Description of Target | This gene encodes one of two proteins which interact with VP16, a herpes simplex virus protein that initiates virus infection. Both the encoded protein and the original Herpes host cell factor interact with VP16 through a beta-propeller domain. The original Herpes host cell factor, however, is effective at initiating viral infection while the encoded protein is not. Transcripts of varying length due to alternative polyadenylation signals have been described. |
| Uniprot ID | Q9Y5Z7 |
| Protein Accession # | NP_037452.1 |
| Protein Size (# AA) | 792 |
| Molecular Weight | 87 kDa |
| Protein Interactions | HHV8GK18_gp81; ASH2L; IRF2; KMT2A; WDR5; RBBP5; MEN1; HCFC1; |
