HCFC1R1 Antibody - middle region - FITC
Cat# ARP56149_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
HCFC1R1 Antibody - middle region : FITC (ARP56149_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-HCFC1R1 (ARP56149_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HCFC1R1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HCFC1R1 (ARP56149_P050-FITC) antibody is Catalog # AAP56149 (Previous Catalog # AAPP37922) |
| Reference | Mahajan,S.S., (2002) J. Biol. Chem. 277 (46), 44292-44299 |
|---|---|
| Gene Symbol | HCFC1R1 |
| Gene Full Name | Host cell factor C1 regulator 1 (XPO1 dependent) |
| Alias Symbols | HPIP |
| NCBI Gene Id | 54985 |
| Protein Name | Host cell factor C1 regulator 1 |
| Description of Target | HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus. |
| Uniprot ID | Q9NWW0 |
| Protein Accession # | NP_001002018 |
| Nucleotide Accession # | NM_001002018 |
| Protein Size (# AA) | 138 |
| Molecular Weight | 15kDa |
| Protein Interactions | APP; HMP19; HCFC1; |
