GMPR Recombinant Protein
Cat# OPCA02075-20UG
Size : 20ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
GMPR Recombinant Protein (Human) (OPCA02075)
| Datasheets/Manuals | Printable datasheet for GMPR Recombinant Protein (Human) (OPCA02075) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Human |
| Additional Information | Relevance: Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS |
| Protein Sequence | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 1-345 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Two structural genes on different chromosomes are required for encoding the major subunit of human red cell glucose-6-phosphate dehydrogenase.Kanno H., Huang I.Y., Kan Y.W., Yoshida A.Cell 58:595-606(1989) |
|---|---|
| Gene Symbol | GMPR |
| Gene Full Name | guanosine monophosphate reductase |
| Alias Symbols | GMP reductase 1, GMPR 1, GMPR1, guanine monophosphate reductase, guanosine 5'-monophosphate oxidoreductase 1, guanosine monophosphate reductase 1. |
| NCBI Gene Id | 2766 |
| Protein Name | GMP reductase 1 |
| Description of Target | Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. |
| Uniprot ID | P36959 |
| Protein Accession # | NP_006868.3 |
| Nucleotide Accession # | NM_006877.3 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 53.4 kDa |
