GH1 antibody - C-terminal region
Cat# ARP41762_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
GH1 Antibody - C-terminal region (ARP41762_P050)
| Datasheets/Manuals | Printable datasheet for anti-GH1 (ARP41762_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Goat, Guinea Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 85%; Goat: 83%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Sheep: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | Available upon request |
| Gene Symbol | GH1 |
|---|---|
| Gene Full Name | Growth hormone 1 |
| Alias Symbols | GH, GHN, GH-N, GHB5, IGHD2, hGH-N, IGHD1A, IGHD1B |
| NCBI Gene Id | 2688 |
| Protein Name | Somatotropin |
| Description of Target | The function of this protein remains unknown. |
| Uniprot ID | P01241-2 |
| Protein Accession # | NP_072053 |
| Nucleotide Accession # | NM_022559 |
| Protein Size (# AA) | 202 |
| Molecular Weight | 23kDa |
| Protein Interactions | GHR; BAG3; BTRC; PRLR; GH1; SHC1; STRAP; LTA4H; |
