Frg1 Antibody - middle region - HRP
Cat# ARP54731_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
Frg1 Antibody - middle region : HRP (ARP54731_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-Frg1 (ARP54731_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Frg1 (ARP54731_P050-HRP) antibody is Catalog # AAP54731 (Previous Catalog # AAPP31526) |
| Gene Symbol | Frg1 |
|---|---|
| Gene Full Name | FSHD region gene 1 |
| Alias Symbols | - |
| NCBI Gene Id | 14300 |
| Protein Name | Protein FRG1 |
| Description of Target | Frg1 may have a role in processing of pre-rRNA or in the assembly of rRNA into ribosomal subunits and also may be involved in pre-mRNA splicing |
| Uniprot ID | P97376 |
| Protein Accession # | NP_038550 |
| Nucleotide Accession # | NM_013522 |
| Protein Size (# AA) | 258 |
| Molecular Weight | 28kDa |
| Protein Interactions | Eed; Pou5f1; |
