DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc)

Cat# NB-64-49203-5ug

Size : 5ug

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions. DsDNA-binding protein A Protein, Enterobacteria phage T4, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 17.8 kDa and the accession number is P13320.
Species
Enterobacteria phage T4
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP13320
Synonyms
rpbB,DsDNA-binding protein A,dsbA,Double-stranded DNA-binding protein
Amino Acid
MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK
Construction
1-89 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight17.8 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
May play a role in transcription of several T4 genes. Binds double-stranded DNA and interacts preferentially with T4 late promoter regions.

Citations