Images
QC Test

  • Specifications

    Product Description

    Human DAF full-length ORF ( NP_000565.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,small size,trial size

    Sequence

    MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    67.8

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — CD55

    Entrez GeneID

    1604

    GeneBank Accession#

    NM_000574.2

    Protein Accession#

    NP_000565.1

    Gene Name

    CD55

    Gene Alias

    CR, CROM, DAF, TC

    Gene Description

    CD55 molecule, decay accelerating factor for complement (Cromer blood group)

    Omim ID

    125240

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

    Other Designations

    CD55 antigen|decay accelerating factor for complement

  • Interactomes
  • Pathways
  • Diseases
  • Publication Reference
    • Single-Molecule Bioelectronic Portable Array for Early-Diagnosis of Pancreatic Cancer Precursors.

      Enrico Genco, Francesco Modena, Lucia Sarcina, Kim Björkström, Celestino Brunetti, Mario Caironi, Mariapia Caputo, Virginia Maria Demartis, Cinzia Di Franco, Giulia Frusconi, Lena Haeberle, Piero Larizza, Maria Teresa Mancini, Ronald Österbacka, William Reeves, Gaetano Scamarcio, Cecilia Scandurra, May Wheeler, Eugenio Cantatore, Irene Esposito, Eleonora Macchia, Fabrizio Torricelli, Fabrizio Antonio Viola, Luisa Torsi.

      Advanced Materials 2023 Jul; e2304102.

      Application:chem-SAM, N/A, Recombinant proteins.