Cor a 1 Recombinant Protein
Cat# OPCA03408-20UG
Size : 20ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
Cor a 1 Recombinant Protein (European hazel) (OPCA03408)
| Datasheets/Manuals | Printable datasheet for Cor a 1 Recombinant Protein (European hazel) (OPCA03408) |
|---|
| Predicted Species Reactivity | Corylus avellana |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Corylus avellana |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN |
| Protein Sequence | GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 2-160 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Four recombinant isoforms of Cor a I, the major allergen of hazel pollen, show different IgE-binding properties.Breiteneder H., Ferreira F., Hoffmann-Sommergruber K., Ebner C., Breitenbach M., Rumpold H., Kraft D., Scheiner O.Eur. J. Biochem. 212:355-362(1993) |
|---|---|
| Alias Symbols | Allergen Cor a I. |
| Protein Name | Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16 |
| Uniprot ID | Q08407 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 33.4 kDa |