CMAS antibody - N-terminal region

Cat# ARP48845_P050

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

CMAS Antibody - N-terminal region (ARP48845_P050)

Datasheets/ManualsPrintable datasheet for anti-CMAS (ARP48845_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CMAS
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF
Concentration0.5 mg/ml
Blocking PeptideFor anti-CMAS (ARP48845_P050) antibody is Catalog # AAP48845 (Previous Catalog # AAPP28894)
ReferenceKutsenko,A.S., (2002) Nucleic Acids Res. 30 (14), 3163-3170
Gene SymbolCMAS
Gene Full NameCytidine monophosphate N-acetylneuraminic acid synthetase
Alias SymbolsCSS
NCBI Gene Id55907
Protein NameN-acylneuraminate cytidylyltransferase
Description of TargetCMAS is an enzyme that catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.
Uniprot IDQ8NFW8
Protein Accession #NP_061156
Nucleotide Accession #NM_018686
Protein Size (# AA)434
Molecular Weight48kDa
Protein InteractionsSUMO2; SUMO3; UBC; FBXO6; APP; SIGLEC12;

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
ARP49696_P050
 100ul 
ARP46705_T100
 100ul 
ARP45410_P050
 100ul