Citrullinated amyloid-β (1-40) peptide (human)
Cat# NB-64-132053-10mg
Size : 10mg
Brand : Neo Biotech
Citrullinated amyloid-β (1-40) peptide (human) (Synonyms: Citrullinated Aβ40, Citrullinated Aβ (1-40))
Catalog No. TP3454 Copy Product Info
Citrullinated amyloid-β(1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) that has undergone citrullination at the Arg5 position. Compared to the unmodified β-Amyloid (1-40), it exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of twisted parallel β-sheets.
Citrullinated amyloid-β (1-40) peptide (human)
Copy Product InfoSynonyms Citrullinated Aβ40, Citrullinated Aβ (1-40)
Citrullinated amyloid-β(1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) that has undergone citrullination at the Arg5 position. Compared to the unmodified β-Amyloid (1-40), it exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of twisted parallel β-sheets.
Citrullinated amyloid-β
(1-40) peptide
(human)
(1-40) peptide
(human)
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Citrullinated amyloid-β(1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) that has undergone citrullination at the Arg5 position. Compared to the unmodified β-Amyloid (1-40), it exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of twisted parallel β-sheets. |
| Synonyms | Citrullinated Aβ40, Citrullinated Aβ (1-40) |
| Formula | C194H294N52O59S |
| Sequence | Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Sequence Short | DAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |

