Reagents and instruments for immunology, cell biology and molecular biology.
 
> Chemokine Receptor D6 (ACKR2) (NM_001296) Human Mass Spec Standard

Chemokine Receptor D6 (ACKR2) (NM_001296) Human Mass Spec Standard

Print Print
Please log in

Cat# PH302459

Size : 10ug

Contact local distributor :


Phone :

Chemokine Receptor D6 (ACKR2) (NM_001296) Human Mass Spec Standard

Be the first to review this product
SKU
PH302459
CCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001287)
 

Other products for "Chemokine Receptor D6 or NM_001296"

  • cDNA Clones
  • Lentiviral
  • AAV
  • CRISPR
  • RNAi
  • Proteins
  • Antibodies
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202459
Predicted MW 43.4 kDa
Protein Sequence
Protein Sequence
>RC202459 protein sequence
Red=Cloning site Green=Tags(s)

MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMV
LLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSL
DKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFGGHGTIWKLFL
RFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQV
FGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES
SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001287
RefSeq Size 2978
RefSeq ORF 1152
Synonyms CCBP2; CCR9; CCR10; CMKBR9; D6; hD6
Locus ID 1238
UniProt ID O00590
Cytogenetics 3p22.1
Summary This gene encodes a beta chemokine receptor, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cells to the inflammation site. This gene is expressed in a range of tissues and hemopoietic cells. The expression of this receptor in lymphatic endothelial cells and overexpression in vascular tumors suggested its function in chemokine-driven recirculation of leukocytes and possible chemokine effects on the development and growth of vascular tumors. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown. This gene is mapped to chromosome 3p21.3, a region that includes a cluster of chemokine receptor genes. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, GPCR, Transmembrane
FAQs
  • Protein FAQs
SDS
SKU Description Size
LC400518 Lyophilized ACKR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY400518 Transient overexpression lysate of chemokine binding protein 2 (CCBP2) (as WB positive control) 100 ug
TP302459 Recombinant protein of human chemokine binding protein 2 (CCBP2), 20 µg 20 ug
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products