CDK7 Antibody - middle region : FITC
Cat# P100995_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-CDK7 (P100995_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CDK7 |
Predicted Homology Based on Immunogen Sequence | Cow: 80%; Dog: 86%; Guinea Pig: 78%; Horse: 86%; Human: 100%; Pig: 86%; Rat: 86% |
Peptide Sequence | Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-CDK7 (P100995_P050-FITC) antibody is Catalog # AAP31342 (Previous Catalog # AAPP02093) |
Reference | Li,Y., (2007) Lung Cancer 58 (2), 171-183 |
---|---|
Gene Symbol | CDK7 |
Gene Full Name | Cyclin-dependent kinase 7 |
Alias Symbols | CAK, CAK1, HCAK, MO15, STK1, CDKN7, p39MO15 |
NCBI Gene Id | 1022 |
Protein Name | Cyclin-dependent kinase 7 |
Description of Target | CDK7 is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P50613 |
Protein Accession # | NP_001790 |
Nucleotide Accession # | NM_001799 |
Protein Size (# AA) | 346 |
Molecular Weight | 39kDa |
Protein Interactions | UBC; RPA3; RPA2; RPA1; GTF2H4; GTF2H3; GTF2H2; GTF2H1; ERCC5; ERCC3; ERCC2; CDK7; CCNH; ATP2B4; A2M; GTF2H5; SRPK2; SRPK1; MNAT1; TP53; CDK2; CTD; MBP; CDK1; CCNB1; CCNA2; Dlg4; UVSSA; HSP90AA1; HSD17B4; HLA-DQA1; SUPT5H; POLR2A; GTF2E2; GTF2E1; CDK9; APP |