CD34, N-His, recombinant protein

Cat# NB-21-25755

Size : 100ug

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P28906
Molecular weight:
29.80 kDa
His Ser32–Thr290

Specifications CD34, N-His, recombinant protein

Product name CD34, N-His, recombinant protein
Uniprot ID P28906
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
Molecular weight 29.80 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser32-Thr290
Protein Accession P28906
Reference PX-P5617
Note For research use only
Molecular Constructor
His Ser32–Thr290

Documents

3D Representation

CD34, N-His, recombinant protein

Reviews

There are no reviews yet.

Be the first to review “CD34, N-His, recombinant protein” Cancel reply

Related products

  • Pertuzumab Biosimilar - Anti-ERBB2, EGFR2, CD340 mAb binds to Human CD340/ERBB2/HER2 in indirect ELISA Assay

    PX-TA1058

    Pertuzumab Biosimilar – Anti-ERBB2, EGFR2, CD340 mAb – Research Grade