ANXA13 Antibody - N-terminal region - HRP
Cat# ARP36591_T100-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
ANXA13 Antibody - N-terminal region : HRP (ARP36591_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-ANXA13 (ARP36591_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA13 |
| Predicted Homology Based on Immunogen Sequence | Dog: 77%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 82%; Pig: 100%; Rabbit: 85%; Rat: 82% |
| Peptide Sequence | Synthetic peptide located within the following region: EPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANXA13 (ARP36591_T100-HRP) antibody is Catalog # AAP36591 (Previous Catalog # AAPP07824) |
| Reference | Iglesias,J.M., et al., (2002) Mol. Biol. Evol. 19 (5), 608-618 |
|---|---|
| Gene Symbol | ANXA13 |
| Gene Full Name | Annexin A13 |
| Alias Symbols | ISA, ANX13 |
| NCBI Gene Id | 312 |
| Protein Name | Annexin A13 |
| Description of Target | ANXA13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. |
| Uniprot ID | P27216 |
| Protein Accession # | NP_001003954 |
| Nucleotide Accession # | NM_001003954 |
| Protein Size (# AA) | 357 |
| Molecular Weight | 39kDa |
| Protein Interactions | NEDD4; UBC; KIFC3; NMT1; |
