ANGPTL3 antibody - N-terminal region
Cat# ARP42412_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
ANGPTL3 Antibody - N-terminal region (ARP42412_P050)
| Datasheets/Manuals | Printable datasheet for anti-ANGPTL3 (ARP42412_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB, IHC |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANGPTL3 (ARP42412_P050) antibody is Catalog # AAP42412 (Previous Catalog # AAPP24758) |
| Enhanced Validation | Relative Expression (Western Blot)  |
| Reference | Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197 |
|---|---|
| Gene Symbol | ANGPTL3 |
| Gene Full Name | Angiopoietin-like 3 |
| Alias Symbols | ANL3, ANG-5, FHBL2, ANGPT5 |
| NCBI Gene Id | 27329 |
| Protein Name | Angiopoietin-related protein 3 |
| Description of Target | The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil dom |
| Uniprot ID | Q9Y5C1 |
| Protein Accession # | NP_055310 |
| Nucleotide Accession # | NM_014495 |
| Protein Size (# AA) | 460 |
| Molecular Weight | 54 kDa |
| Protein Interactions | UBC; ITGAV; ITGB3; ITGA5; |
