AMDHD1 Antibody - N-terminal region - HRP

Cat# ARP52962_P050-HRP

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

AMDHD1 Antibody - N-terminal region : HRP (ARP52962_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-AMDHD1 (ARP52962_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AMDHD1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV
Concentration0.5 mg/ml
Blocking PeptideFor anti-AMDHD1 (ARP52962_P050-HRP) antibody is Catalog # AAP52962 (Previous Catalog # AAPP40905)
Reference0
Gene SymbolAMDHD1
Gene Full NameAmidohydrolase domain containing 1
Alias SymbolsHMFT1272
NCBI Gene Id144193
Protein NameProbable imidazolonepropionase
Description of TargetThe function of this protein remains unknown.
Uniprot IDQ96NU7
Protein Accession #NP_689648
Nucleotide Accession #NM_152435
Protein Size (# AA)426
Molecular Weight47kDa
Protein InteractionsUBC;